v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)(M09), clone 5C6
ANG-000027-M09
Product Description:
Mouse monoclonal antibody raised against a partial recombinant ABL2.
Immunogen:
ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence (without GST):
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Cross Reactivity:
Human
Isotype:
IgG3 Kappa
Storage Buffer:
In 1x PBS, pH 7.2
Storage Instruction:
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality Control Testing:
Antibody Reactive Against Recombinant Protein. Western Blot detection against Immunogen (37 KDa) .
Western Blot (Cell lysate)
ABL2 monoclonal antibody (M09), clone 5C6 Western Blot analysis of ABL2 expression in K-562 ( Cat # L009V1 ).
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ABL2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.5 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to ABL2 on HeLa cell. [antibody concentration 10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABL2 is approximately 0.1ng/ml as a capture antibody.
ELISA
Entrez GeneID:
27
GeneBank Accession#:
BC065912
Protein Accession#:
AAH65912
Gene Name:
ABL2
Gene Alias:
ABLL, ARG, FLJ22224, FLJ31718, FLJ41441
Gene Description:
v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Omim ID:
164690
Gene Ontology:
Hyperlink
Gene Summary:
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Other Designations:
Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson-related gene protein, OTTHUMP00000033139, arg tyrosine kinase, v-abl Abelson murine leukemia viral oncogene homolog 2